Tag Archives: IHSAA Limited Contact Period

VanArsdale builds Elkhart Christian culture of humility, hard work

RBILOGOSMALL copy

BY STEVE KRAH

http://www.IndianaRBI.com

When Tyler VanArsdale was asked to be the varsity baseball coach at Elkhart (Ind.) Christian Academy, the invitation came with a request.

Athletic director Richelle Viront wanted him to establish culture with the Eagles.

VanArsdale, a 2013 ECA graduate who had played baseball, golf and basketball at his alma mater, was a baseball assistant in 2017 and came back to lead the program in 2019.

“I’ve been preaching to the guys to stay humble and work hard,” says VanArsdale. “Humility is so valuable in a team sport.”

VanArsdale, who had also coached many of these same athletes as junior high basketball players, does not put the emphasis on personal statistics but the team.

“We talked about distractions,” says VanArsdale. “One huge one is pride.”

VanArsdale wants his players to know that “everyone matters” and that seniors with experience respect freshmen with little to none.

“When I see someone who is toxic to that culture, we’re addressing it head-on right away,” says VanArsdale. “At the end of the day, ECA baseball is about life development.”

VanArsdale saw the Eagles go from 1-11 in 2018 — a year he stayed out of coaching with the birth of his daughter (Bethel College graduates Tyler and Brittany welcomed Clara on their wedding anniversary of May 10, 2018 at 10:18 p.m.) — to 8-8 in 2019 with him in charge.

“It’s a mindset thing — a change in thinking,” says VanArsdale. “That’s a great turnaround.”

Elkhart Christian lost 4-0 to Fremont in the semifinals of the IHSAA Class 1A Fremont Sectional.

“It was intense and competitive,” says VanArsdale. “I was proud of the guys.”

Two seniors — Bailey Petty and Mark Stevens — were on that squad. Many players return for 2020. Stevens has joined a coaching staff that also includes Tony Tice and Chad Viront.

VanArsdale started his high school athletic career at nearby Penn.

As a sophomore, he transferred to ECA. He was allowed to play junior varsity basketball. The Eagles did not have a JV baseball team, but an arm injury ended his travel season early.

VanArsdale played basketball as a junior and season for squads that won 13 and 14 games.

His senior spring saw ECA go 21-8 and win the school’s first baseball sectional title, reigning at Hamilton and advancing to the finals of the 1A Caston Regional.

That team featured Caleb Stayton (who went on to a standout career at Ball State University) and Tanner Watson (who excelled at Taylor University) and VanArsdale keeps in-touch with many of his former teammates.

A former golf mate of Alec Dutkowski, VanArdale was also able to juggle the links and the diamond in the spring at ECA. He anticipates that he will have some baseball players also competing in track and field this spring.

During the IHSAA Limited Contact Period, the Eagles have been practicing on Tuesdays and Saturdays with weight workouts on other days.

Players and coaches are communication via group chat and VanArsdale, who is also account manager for Legacy Fire Protection, has lunch with his seniors — a group that will have at least six.

“I’m excited,” says VanArsale. “1 through 9, we’ll be stronger at the plate.

“With pitching, we lost Bailey Petty. But we’ll be more diverse and may use three pitchers in a game.”

To keep his pitchers healthy, VanArsdale has them using J-Bands, lifting weights and stretching in the off-season.

For those players who have their sights on the next level, the coach has advice.

“If you have a goal to play college ball, I preach prospect camps,” says VanArsdale. “You don’t want to get worn out on travel ball.”

While ECA (enrollment around 170) is an independent in all sports but soccer now, the school will be part of the Hoosier Plains Conference (with Argos, Bethany Christian, Lakeland Christian Academy, South Bend Career Academy and Trinity at Greenlawn), beginning in 2020-21. It will come with a double robin schedule and end-of-season recognition.

“It’s going to be really good,” says VanArsdale. “It’ll give each school something to shoot for.”

The Eagles are part of a 1A sectional grouping in 2020 and 2021 with Bethany Christian, Fort Wayne Blackhawk Christian, Fort Wayne Canterbury, Fremont, Hamilton and Lakewood Park Christian.

BAILEYPETTYTYLERVANARSDALEMARKSTEVENS

Elkhart (Ind.) Christian Academy head baseball coach Tyler VanArsdale (center) appears with Bailey Petty (left) and Mark Stevens on Senior Day 2019.

Carlton, Shelbyville Golden Bears embracing technology, sabermetrics

RBILOGOSMALL copy

BY STEVE KRAH

http://www.IndianaRBI.com

Shelbyville (Ind.) High School baseball has made a commitment to technology.

Through the generosity of parents, donors and the SHS athletic department, the Golden Bears have provided head coach Royce Carlton, his staff and team with several modern tools.

Among those are a 4D Motion 3D motion capturing system, Rapsodo Hitting 2.0, Rapsodo Pitching 2.0, Driveline EDGE, Driveline TRAQ and velocity sensors for the weight room. On the wish list is a Sony slow-motion camera.

But all the gadgets are no good if the data they provide can’t be understood by coaches and players or used is effective ways.

With that in mind, Carlton recruited smart students to be part of the Shelbyville Sabermetrics department. So far there’s juniors Christian DeRolf and Austin Perry and senior Eric Santiago.

“We wanted to squeeze as much baseball out of our players as we possibly could,” says Carlton, a graduate of Morristown Junior/High School (2010) and the University of Indianapolis (2014) who is entering his third season at Shelbyville in 2020. “I saw a couple of college Twitter accounts where they had an analytics team or sabermetrics department.

“I’ve never heard of this done at the high school level so let’s give it a shot.”

The sabermetrics team, which was formed in September, is comprised of students near the top of their class.

“They’re real interested in the game of baseball,” says Carlton. “They may not have the ability to play but they still love the sport. This gives them a chance to help out and be part of the team. They’re just as important as my players as far as I’m concerned.”

DeRolf expresses his excitement about mining the data for information that can help his schoolmates.

“There’s such an opportunity to quantify absolutely everything,” says DeRolf, who sees himself going to college for information systems/computer science and continuing to apply his knowledge to baseball. “It’s not easy to change somebody’s behavior and see that there might be somebody better than what they’re doing.

“But there’s nothing wrong with being able to tweak things. Once they see how this helps, they tend to trust you. The trust is the hardest part to build.”

Santiago was invited to join the sabermetrics team by DeRolf. Before he goes to college to pursue a finance degree, Santiago will crunch the numbers to help the baseball team.

As the Golden Bears work out this winter, they will all be figuring out the best practices.

“It’s a learning process,” says Santiago. “Nobody’s an expert. Everybody is going to learn together.

“We’ll focus on basics and fix small things so we can go onto bigger things.”

Driveline EDGE helps with pitch design. Driveline TRAQ allows for individualized practice plans for each player (who will bring iPads to practice during the off-season to focus on their specific needs). Sensors on bar bells check to see that players are strong and moving in an explosive way.

“It’s not a cookie-cutter approach,” says Carlton. “One reason we got the 4D Motion 3D motion capturing system is slow-motion video can lie. You have clothes on. It hides things. To really be able to see the kinematic sequence for the right order of each body part firing, we had to get the sensors. I didn’t want to teach my guys something I saw on video that might actually be wrong.”

Prior to the next IHSAA Limited Contact Period (which began Dec. 9), Carlton tested the system by taking cuts himself.

“My video looked good, but when I went to the sensors my chest was actually firing before my pelvis,” says Carlton. “So I worked on changing that, where my pelvis would fire before my chest. I added 5 mph on to my bat speed just within a 20-minute session.”

Carlton, who is also the head strength and conditioning coach at Shelbyville, says there is a dynamic in athletics of “feel vs. real” and technology can help with that.

“Now, we can match the real with the feel instead of just guessing,” says Carlton. “A lot of it has been guessing up to this point.

“We can really bridge that gap.”

There’s also a learning curve for coaches.

“Technology’s just blowing up in baseball. Coaches don’t understand how to interpret. They get all these numbers. But what good do the numbers do unless you actually know how to transfer it to high school kids’ minds?

“That can be a chore.”

Carlton says the Golden Bears will be filming every single hitting, pitching and fielding rep through the iPads for analyzation.

“It’s going to be kind of weird having every single player with technology,” says Carlton “It kind of hurts me inside. I’ve still got a little bit of old school in me.

“But the game’s changing.”

Carlton has visited Indiana University to see how the Hoosiers use technology to help their players and recently completed his Driveline pitch design certification. He equates that experience to drinking out of a fire hose.

The program consolidates a great deal of information and involves physics, spin, horizontal and vertical break and much more.

Shelbyville’s plans call for using a pitching report which includes a pitcher’s strengths. Those with high spin rates will generally pitch higher in the strike zone than those with lower spin rates.

“We’re going to get super in-depth,” says Carlton.

Last spring, Shelbyville employed Major League Baseball-style defensive shifts.

“Most of the people on my coaching staff thought I was crazy,” says Carlton. “Most of the teams we played thought I was crazy. But it 100 percent worked for us. Most high school hitters kind of struggle to hit the outside pitches and we’d groove them pitch inside and they’d pull it right into our shift.

“I don’t have any flame throwers. No one who throws over 85 (mph). We had to be really crafty, do the shifts and pitch locations really worked.

“Some didn’t like it, but you’ve got to win.”

Maverick Alexander, one of Carlton’s assistant coaches, does a lot of digging in places like GameChanger and uses historical data against an opponent to put together spray charts to be employed in shifting game plans.

“He puts together a probability packet for us that we go off from batter to batter,” says Carlton, who also counts Mike Jackson, Chase McColley, Jacob Shively and Nate Stonebraker among his assistants. “I think we only got burnt twice all season by shifting and we probably shifted at least 50 percent of the time.

“(My assistants) are all smart. They see what the pro level is doing. We’re at the high school level, but there are still applications we can take. The pros wouldn’t do it if it didn’t win games for them. It’s a money game up there.”

Alexander’s day job is making maps for the State of Indiana. He uses his skills with Excel, Word and data analysis gathered in 2018 and 2019 to produce reports on Shelbyville opponents.

“We hope to be here a long time. It can be a long-term plan,” says Alexander. “If we see a player as a freshman, by the time they are juniors or seniors we’ll be able to see those trends more clearly.”

If possible, players go over Alexander’s pamphlet in practice the day before a game to learn about opponent tendencies and then can go to it during the contest.

“It’s definitely important for pitchers and catchers  to know game plan for each inning,” says Alexander.

Carlton has enjoyed watching the way the athletes have taken to the approach.

“It’s neat,” says Carlton. “The players buy into it. They make it their own.”

Shelbyville (enrollment 1,167) is a member of the Hoosier Heritage Conference (with Delta, Greenfield-Central, Mt. Vernon of Fortville, New Castle, New Palestine, Pendleton Heights and Yorktown).

Beginning in 2020, conference foes will face each other one time on Friday nights. Previously, they had met for Friday doubleheaders.

The Golden Bears are part of an IHSAA Class 4A sectional grouping with Bloomington North, Bloomington South, Columbus East, Columbus North and East Central. Shelbyville has won 10 sectional titles — the last in 2005.

In 2018, the Bears featured pitcher/outfielder Damon Lux (now at Duke University) and first baseman Lucas Steineker and went 13-12 and then 9-17 with a very young varsity team in 2019.

“This year, we’re looking pretty solid,” says Carlton. “We’ve got our pitching and our offense straightened out.

“We do a lot of the (Driveline) command ball stuff — the oversized and undersized balls and weighted balls.”

Since Carlton arrived (he was formerly head baseball coach at Morristown and Attica), two teams — varsity and junior varsity — have been representing the school with 26 to 28 total players.

Blending the new with the old, Carlton also has plans to honor Shelbyville’s baseball past this spring when his team takes the field in throwback jerseys and limited edition hats from a time when the school’s mascot was the Camels.

“I’m trying to find some neat things to do during the spring to get some people out to enjoy the game and teach the guys a little about the history of baseball,” says Carlton, who has consulted with former Shelbyville head coach and history buff Scott Hughes, old school yearbooks and the local historical society. “Back when the game was super-pure.”

ROYCECARLTONSHELBYVILLE

Royce Carlton is entering his third season as head baseball coach at Shelbyville (Ind.) High School in 2020.

 

Frye expects commitment from himself, Logansport Berries

RBILOGOSMALL copy

BY STEVE KRAH

http://www.IndianaRBI.com

Giving it everything he had each time he stepped on the diamond.

That’s what Dan Frye did as a player and that’s what he does as a coach.

Frye was a baseball assistant at his alma mater — Logansport (Ind.) High School. After being away for five seasons, he is now head coach for the Berries.

The 1988 LHS graduate expects his players to share in a sense of commitment.

“The kids should get the same out of me that I expect out of them and that’s being there everyday,” says Frye, who takes over a program that was led for the past 22 seasons by Jim Turner Jr.

Frye was a middle infielder for the Berries when Jim Turner Sr., an Indiana High School Baseball Coaches Association Hall of Famer, was head coach.

“Both are pretty laid-back guys,” says Frye of the Turners. “It takes a lot to get them excited. They wanted the accountability to be on the players and leave it up to the players to get the job done.”

Frye considers both Turners great baseball minds.

“It’s how they think about the game and situations throughout the game,” says Frye. “We’ll continue to work on situations.

“You should be practicing the way you anticipate playing. I practiced as hard as I played. Anything less than that is unacceptable.”

Three Frye brothers were standouts at Logansport and then at Indiana State University of Hall of Fame coach Bob Warn. Older brother Paul Frye played on the 1986 College World Series team and was selected by the Montreal Expos in the 11th round of that year’s Major League Baseball First Year Draft. The outfielder/infielder played four seasons in the minors.

Twins Dan and Dennis started at ISU in 1989.

“My decision was pretty easy,” says Dan Frye. “That’s where I wanted to go. I wanted a part of it.

“Bob Warn was a great coach and it was great to be around him.”

Mitch Hannahs (who is now Indiana State head coach) was a senior shortstop at ISU when Frye was a freshman second baseman.

“I don’t think Indiana State could be in better hands,” says Frye of Hannahs.

Playing in the Missouri Valley Conference, the Frye brothers got to play against several future big leaguers.

“The competition was phenomenal,” says Frye, who counted Mike Farrell (who is now a baseball scout) as a teammate at Logansport and Indiana State.

Among the opponents during Dan and Dennis’ time were 6-foot-5 right-hander Tyler Green, catcher Doug Mirabelli, right-hander Greg Brummett, shortstop Pat Meares, second baseman Mike Lansing, infielder P.J. Forbes and catcher and future big league manager/college head coach Eric Wedge at Wichita State University. IHSBCA Hall of Famer Wedge is now the head coach at WSU.

The Sycamores beat the Shockers 4-of-6 the year Wichita State won the national championship (1989).

“Each level of competition prepared me for the next level,” says Frye. “I was not in shock about seeing a fastball.

“Everybody (in the North Central Conference) threw hard. It was not odd.”

Dan and Dennis were drafted in 1988 by the Los Angeles Dodgers after high school — infielder/outfielder Dan Frye in the 56th round and first baseman/outfielder Dennis Frye in the 57th — but opted for college.

Dan Frye was selected in the 20th round of the 1992 draft by the Cincinnati Reds and played four seasons in the minors.

That first year he played in Princeton, W.Va., and he later began his coaching coach at Princeton High School.

With two small children, Frye moved back to Logansport in 1999 to be closer to family.

A few years later, he began coaching Little League and Babe Ruth baseball around town.

He was hired by the Logansport Police Department in 2002 and worked his way up from patrolman to assistant chief. He spent nearly four years on the narcotics unit. While coaching at Logansport High School, he also served as school resource officer.

There are now three lawmen on the Berries coaching staff — Dan Frye, Clayton Frye (his son and a Logansport detective) and Chris Jones (a Cass County sheriff’s deputy) — plus other former LHS players Brad Platt, Brian Gleitz, Ron Kinnaman and Cooper Kinnaman. Clayton Frye and Gleitz will work with pitchers, Jones with catcher and Platt with outfielders. The Kinnamans and Jones are assigned to the junior varsity team.

Frye looks to have a young first squad in 2020. At this point, there are three seniors — Matt Foutz, C.J. Hallam and Drake McLochlin.

During the fall IHSAA Limited Contact Period, Frye and up to a dozen players got together for workouts.

“I saw some kids field, swing bats and throw,” says Frye. “The numbers weren’t always there to run a legitimate full practice. I was able to see what kids can and can’t do and start working on development stuff with ones who were there.”

Frye is catching up on the pitch count rule (1 to 35 pitches requires 0 days rest; 36 to 60 requires 1 day; 61 to 80 requires 2 days; 81 to 100 requires 3 days; and 101 to 120 requires 4 days), which was not in place the last time he was coaching high school ball.

“I agree with it,” says Frye. “It’s a good rule. It’s about the safety for the kids.

“We have to develop more pitching.

“It’ll be interesting to see how people coach a little differently with the pitch count and all that. I’m sure I’m going to learn some valuable lessons from coaches around here”

With the pitch limit, strike-throwing has become extra important.

“How many pitches can you waste anymore?,” says Frye. “When I played, I didn’t want to stand around taking pitches. One pitch and we’re headed around the base paths. I wanted to hit.”

He recalls hitting the first pitch of a game against Marion out of the park during his sophomore season.

“Walks put runners on base and I see it differently now.”

Logansport (enrollment around 1,250) is a member of the North Central Conference (with Anderson, Harrison of West Lafayette, Indianapolis Arsenal Tech, Kokomo, Lafayette Jeff, Marion, McCutcheon, Muncie Central and Richmond).

The NCC tends to play Tuesdays and Wednesdays with Saturday doubleheaders.

The Berries are part of an IHSAA Class 4A sectional grouping with Harrison (West Lafayette), Kokomo, Lafayette Jeff and McCutcheon. Logansport won its 29th sectional crown in 2019. The Berries have been in the State Finals 10 times with state championships in 1975, 1977, 1979 and 1991 and a state runner-up finish in 1989.

Logansport plays on an artificial turf surface. Jim Turner Field has been covered since the 2016 season.

Dan Frye, 49, is married to Cynthia and has four adult children — Clayton Frye and Krista Frye in Logansport, Dustin Clements in Nashville, Tenn., and Katie Clements in Denver, Colo.

DANFRYEFAMILY

Cynthia and Dan Frye are surrounded by children (from left) Katie Clements, Krista Frye, Dustin Clements, KyLeigh Frye (daughter-in-law) and Clayton Frye. Dan Frye is the head baseball coach at his alma mater — Logansport (Ind,) High School.