Tag Archives: Hamilton

Guthrie, Prairie Heights baseball embrace technology for training

By STEVE KRAH
http://www.IndianaRBI.com

“Kids just love playing video games. They’re playing video games at practice and they love it.” — T.J. Guthrie, head baseball coach at Prairie Heights High School

Always looking for ways to develop his players, Guthrie added Virtual Reality to the Panthers’ practice regimen by bringing in a WIN Reality system which helps hitters with things like pitch recognition.
Athletes don a headset and get a fully-immersive experience, seeing realistic pitches in what looks like a professional stadium.
“I’m constantly scouring the Internet and social media to see what is out there to better our kids,” says Guthrie, who introduced WIN Reality when players returned from winter break in January. “I like to mix up our training routines.
“Some days we don’t get the gym with the batting cage and we can still get in live work. We’re getting that cognitive intuition we need on a much better scale.”
With the WIN Reality, players go through graduated sequence of eight drills. The first is basic, recognizing fastball, curveball and change-up. They are also tracking the pitch. This is done by asking the hitter to point the controller to where the ball ended up in the strike zone.
Later comes the “disappearing pitch” drill where the pitch might go away at 50 feet or less and hitters are still asked to recognize it.
“It really starts to challenge guys,” says Guthrie. “They see their averages at the end (of drills) and the begin competing against each other.”
Guthrie notes that the technology is not new and is used by numerous pro and college teams. Now it has come to Brushy Prairie, Ind.
Using the VR trainer offers an efficient way to see more pitches in less time than would be possible with the traditional methods alone.
“We’re certainly not taking away from the live BP,” says Guthrie. “We’re adding to it in a risk-free environment.”
While identifying these WIN Reality pitches, no swings are taken. Hitters pull the trigger on the controller. The system tells them when they made that decision and if it was in the optimum window of when they could hit the pitch.
“You’re not training your body,” says Guthrie of the VR work. “We’re using this to train the brain.
“We’re using cage to train the body on the proper fundamentals.”
WIN Reality does include an optional bat attachment and collects data on swings.
Guthrie, a 2011 Fremont (Ind.) High School graduate who had his college career ended by injury, embraces tech.
He uses smart baseballs that track spin rates, velocity and movement. There are Blast Motion sensors on his players’ bats to give feedback.
“We’re getting video of guys all the time,” says Guthrie, who likes to shoot 4K at 60 frames-per-second. “We go frame-by-frame and make sure we’re not missing anything.”
A phone app called Coach’s Eye allows for comparative side-by-side videos. It’s helpful for pitchers trying to make all their pitches look the same coming out of their hand.
Guthrie says that pitch recognition training when he was a player involved a VCR.
“We’d see a one-second clip of a ball coming out of the pitcher’s hand,” says Guthrie. “But it did not mix it up like the real pitcher does.”
Guthrie has used YouTube videos for this purpose. There is also a phone app called GameSense Pitch-IQ.
With Guthrie and varsity assistants Mike Gustin (pitching coach), Tyler Christman and Ryan Fulton, junior varsity coaches Gene Smith (head coach), Dave Priestley (pitching coach), Shane Richards and JV statistician Reese Smith, Prairie Heights is preparing to compete in the Northeast Corner Conference (which also includes Angola, Central Noble, Churubusco, Eastside, Fairfield, Fremont, Garrett, Hamilton, Lakeland, West Noble and Westview) and IHSAA Class 2A in 2022.
“The NECC seems to be going in a high-velocity direction,” says Guthrie. “We’ve got a lot of great pitchers in this conference. It was bound to happen because of the push for travel ball. The kids want to get better day in and day out.
“We need to know how we improve at the plate. You’ve got to score runs to win games. The velocity is one thing. It’s the curve balls, sliders and change-ups that are beating us.
“Recognizing the pitch is half the battle.”

Prairie Heights High School baseball uses Virtual Reality technology with a WIN Reality system.
A WIN Reality Screenshot.
A WIN Reality Screenshot.
A WIN Reality Screenshot.

IU Southeast gearing up for first NAIA World Series trip

By STEVE KRAH

http://www.IndianaRBI.com

Indiana University Southeast has been oh-so close to punching its ticket to the NAIA Baseball World Series in recent years.

In 2021, the Grenadiers finally made it and will be in Lewiston, Idaho for the 10-team event, which begins May 28 and runs through June 4.

“We’ve been moving vertically over the last decade,” says Ben Reel, IU Southeast’s 13th-year head coach. “We’ve learned what wins and what doesn’t to win the big game you’ve got to have a lot of resiliency, chemistry and poise.

“That’s what we’re looking at from a recruiting standpoint — those intangibles.”

The Grenadiers have a roster with 20 players from Indiana high schools. In the final game of NAIA Opening Round Kingsport Bracket, there were five of them in the starting lineup.

In that contest against No. 1-ranked Tennessee Wesleyan, this was Reel’s batting order: Lawrenceburg’s Clay Woeste (.371, 7 home runs, 50 runs batted in, 35 stolen bases) at second base, Drew Hensley (Bedford North Lawrence) .402, 0, 15) at first base, Brody Tanksley (Bedford North Lawrence) .355, 18, 69) at catcher, Marco Romero (Caracas, Venezuela) .370, 6, 55) in right field, Derek Wagner (Tri-West Hendricks) .314, 4, 25) in left field, John Ullom (Louisville, Ky.) .361, 5, 42) in center field), Ben Berenda (Lafayette Central Catholic) .247, 0, 32) at designated hitter, Jacob Scott (Huntington Beach, Calif.) .316, 5, 53) at third base and Daunte Decello (Hamilton, Ohio) .366, 1 29) at shortstop.

“I love homegrown players,” says Reel, a native of Dillsboro, Ind., and South Dearborn High School graduate. “There’s something to be said about development.

“This is a program.”

IU Southeast prides itself in having a team full of battlers at the dish.

“We’re definitely going to grind it out at the plate,” says Reel. “We’re tough to strikeout and fast on the bases.”

As a team, the Grenadiers are hitting .332, 62 homers and  526 runs (8.4 per game) with a .949 OPS (.434 on-base percentage plus .515 slugging average).

At 48-14 (including 26 in the River States Conference), the 2021 IU Southeast team has tied the school record for single-season victories set in 2017.

But it hasn’t been all smooth sailing. 

Including being swept in a four-game home series Feb. 26-27 against Huntington (which wound up 33-16), the Grenadiers got off to a 5-10 start.

Since March 3, IU Southeast is 43-4 with win streaks of 18, 14 and six games (current).

After going 26-1 during the River States Conference regular season, the Grenadiers beat Point Park (40-16) to win the RSC tournament title.

The Kingsport (Tenn.) NAIA Opening Round saw IUS win one-run games against Warner (33-23) and No. 1-ranked Tennessee Wesleyan before another World Series berth-clinching win against the Bulldogs (53-6).

Along the way, IU Southeast has had to deal with injuries (RSC Player of the Year and New Lenox, Ill., native Matt Monahan, who hit 428 with 14 homers and 55 RBIs, went out with a season-ending ailment late) and then there’s been all the COVID-19 testing, virtual classes and other issues.

“We’ve been through a lot of trials and tribulations,” says Reel. “But it’s not about what people think you’re supposed to do, it’s about what you’re actually going to do. 

“We’ve focused on the little things. We’ve always tried to put our team in the best situation. You have to plan ahead or you’re going to plan to fail.”

The Grenadiers’ pitching strength comes from its depth. It’s not an insult to say “Johnny Wholestaff” is pitching today.

“Johnny’s alive and well down here,” says Reel. “That’s given us a lot of confidence.”

Left-hander Hunter Kloke (Henderson, Ky.) is 9-1 with a 3.01 earned run average and has made 17 mound appearances (14 starts).

Right-hander Cade Reynolds (Greensburg) is 5-2 with a 3.45 ERA with 15 appearances (13 starts).

Besides his first base duties, right-hander Hensley is 8-3 with a 5.21 ERA on the bump with 16 appearances (12 starts).

Lefty Trevor Reynolds (Greensburg) is 9-1 with a 2.81 ERA. All but three of his 22 games are in relief.

There are eight other pitches with at least 10 appearances.

The saves leaders are right-hander Jacob Frankel (Louisville, Ky.) with four at a 1-1 record, righty Brenden Bube (Lanesville) with three at 4-3 mark and right-hander Lane Oesterling (Batestville) with two and a 5-1 ledger.

“The moment has not too big for (our pitchers),” says Reel. “We’ve made some great plays defensively.

“When we need to make a play we’ve found a way to make it.”

While the NAIA World Series will be a first-time experience for Reel and his program, he will be among friends Idaho.

LSU Shreveport (La.) coach Brad Neffendorf is probably Reel’s best friend in baseball. They were groomsmen in each other’s weddings and Reel is the godfather to Kash Neffendorf.

Jeremy Sheetinger will have his Georgia Gwinett team there. Reel knows Sheets from his days at Brescia. 

Reel also counts Southeastern (Fla.) coach Adrian Dinkel as a buddy and he met Central Methodist (Mo.) coach Nate Breland this past year.

The field will also feature Concordia (Neb.), Faulkner (Ala.), Keiser (Fla.), Lewis-Clark State (Idaho) and Oklahoma Wesleyan.

Reel and his team are learning about all the travel details that goes with playing across the country.

Then there’s the fact that he came home to wife Morgan and newborn son Beckham (born April 24 and in NICU for the first seven days) and water issues at the house.

“It’s been a whirlwind,” says Reel. “I guess (my son) is my lucky charm.”

Ben Reel (Indiana University Southeast Photo)

Baker, Flemm guiding Elkhart Christian Academy Eagles

By STEVE KRAH

http://www.IndianaRBI.com

A 30-something from Indiana and a 20-something from New Jersey have come together to lead the baseball program at Elkhart (Ind.) Christian Academy.

Shawn Baker, 34, and Matthew Flemm, 24, are co-head coaches for the Eagles. 

Baker graduated from Northridge High School (Middlebury, Ind.) in 2005 and Manchester University (North Manchester, Ind.) in 2009 as a Grades 5-12 Social Studies major.

He played at Northridge for two head coaches — Mike Logan and Troy Carson. Rick Espeset was his coach for four seasons at Manchester.

Northridge was very competitive in Baker’s junior and senior seasons and the friendships started off the field carried on to it.

“We’d have our backs there, too,” says Baker.

“Both Mike and Troy instilled the hard-nosed baseball philosophy in us as players,” says Baker of Logan and Carson. “It’s working hard in practice and seeing the transfer over in games.

“I learned a lot from Coach Espeset about the ‘why’ and the philosophy of the game of baseball.”

As an educator, Baker was at South Bend (Ind.) Career Academy and Westview High School in Topeka, Ind., and has been at Northridge Middle School for the past eight years, teaching eighth grade Social Studies and coaching seventh grade boys basketball.

He has served an assistant baseball coach at Dowagiac (Mich.) Union High School and Westview for Warriors head coach Jason Rahn.

“I had been getting the itch to coach baseball again,” says Baker, who applied at ECA and was hired in mid-February. The first official day of practice was March 15.

Baker has been married for eight years. Shawn and Heather have a girl and two boys — Aleah (6), Colson (4) and Bennett (2).

Shawn’s younger brother, Shannon Baker, played at Northridge and Indiana Purdue Fort Wayne and is now an assistant to A.J. Risedorph at NorthWood High School in Nappanee, Ind.

Flemm is an alum of Veritas Christian Academy in Sparta, N.J., where he pitched for the Lions baseball team and graduated in 2015. He finished his course work at Cedarville (Ohio) University as a History major and double minor in International Studies and Bible in December and is planning to attend May 1 commencement. 

He was contacted by former Veritas Christian administrator and current Elkhart Christian secondary principal Sean Bevier who informed him of the baseball coach opening. Flemm was working with the Sussex County Miners Travel Baseball 13U team. Besides coaching, he is substitute and study hall teacher at ECA.

Baker and Flemm, who are assisted by former Elkhart Christian players Mark Stevens and T.J. Tice, guide a group of 12 players that includes one senior (Matt Elmerick), no juniors and the rest sophomores and freshmen.

Some have played travel ball. Others have little baseball experience.

“It sounds cliche’, but we’re working on getting better each day,” says Baker. “We want them listening to what we tell them and trying to apply it on the field.”

Three — Elmerick and sophomores Jude Reynolds and Luke Schramm — split their time between baseball and the Eagles track and field team coached by Allen Lollis. With the help of athletic director Richelle Viront, game and practice schedules are coordinated to accommodate both spring programs.

Elkhart Christian Academy (enrollment around 160) is a member of the Hoosier Plains Conference (with IHSAA Class 1A schools Argos, Bethany Christian, Lakeland Christian Academy, South Bend Career Academy and Trinity at Greenlawn). Only ECA, Argos, Bethany have baseball teams this spring.

The Eagles are part of an 1A sectional grouping with Bethany Christian, Fort Wayne Blackhawk Christian, Fort Wayne Canterbury, Fremont (the 2021 host), Hamilton and Lakewood Park Christian. ECA won a sectional title in 2013. 

Besides conference and sectional foes, ECA’s regular-season schedule includes games with 4A’s Concord, Mishawaka and South Bend Riley, 3A’s Culver Academy, John Glenn, Lakeland and NorthWood, 2A’s Bremen and LaVille and 1A’s Culver Community and Oregon-Davis.

“We play a lot of these really big school,” says Flemm. “That’s going to set us up for success in the conference and a state tournament time.”

The Eagles are trying to develop pitchers and catchers on the fly. Many will get a turn on the mound.

“Everybody’s a pitcher until we figure out that’s not your forte’,” says Baker. 

Something that was ingrained during Flemm’s travel and high school pitching career was the importance of control.

“Throwing strikes is the only way you’re going to succeed,” says Flemm. “Our second game (against LaVille) we had more strikes and that was awesome to see.

“It’ll just take a lot of refinement and more experience for the guys on the bump.”

Baker looks for ECA pitchers to develop a fastball and change-up and be able to hit their spots with it.

Flemm is upbeat about the future.

“We see a lot of potential,” says Flemm. “It’s been a blessing working with this group of guys.

“I’m excited for what’s coming and how we can develop these guys even more.”

As a private K-12 school, ECA does not always know who will be attending from year to year.

Flemm says there has been talk of starting a junior high baseball program. He has noticed interest in the game among students in those grades.

“It’s something, hopefully, Coach Baker and I can start.” says Flemm, who notes that he and Baker will lead a youth baseball camp ECA in early June. “We’ll get a chance to see what kind of talent we have coming in.”

The Elkhart Christian campus is located in an open area behind the school and next to the U.S. 20 By-Pass. A breeze seemingly never stops.

“We’re almost in a wind tunnel,” says Baker. “It can be difficult to hear (talk between players and coaches and players and other players). 

“We need to work on communication and use our big-boy voices so people can hear.”

Shawn Baker
Matthew Flemm

NEIBA looking for Dick Crumback HS Player of the Year nominees

By STEVE KRAH

http://www.IndianaRBI.com 

The Northeast Indiana Baseball Association has been recognizing local baseball players, personnel and ambassadors through a Hall of Fame and honors program since 1961.

Each year, these honorees are saluted at a banquet. In 2018, South Adams’ Grant Besser was the Dick Crumback Player of the Year. The COVID-19 pandemic took away the award and banquet in 2020.

Baseball coaches from Adams (Adams Central, Bellmont, South Adams), Allen (Bishop Dwenger, Bishop Luers, Blackhawk Christian, Canterbury, Carroll, Concordia Lutheran, Heritage, Homestead, Leo, New Haven, North Side, Northrop, Smith Academy for Excellence, Snider, South Side, Wayne, Woodlan), DeKalb (DeKalb, Eastside, Garrett, Hamilton, Lakewood Park Christian), Noble (Central Noble, East Noble, West Noble), Huntington (Huntington North), Wells (Bluffton, Norwell, Southern Wells) and Whitley (Churubusco, Columbia City, Whitko) counties were emailed and asked to nominate any player(s) that he feels could be in the running for the 2021 Dick Crumback/NEIBA Player of the Year Award. The deadline for submitting players is on 11:59 p.m. on Friday, March 12.

On Sunday, March 14, the NEIBA will be sending out the list of players that are on the “watch list” for this year’s award. 

First off, the award is named after longtime amateur baseball supporter Dick Crumback. The Crumback family has also given a $500 annual scholarship to the high school baseball program recipient. 

The Fort Wayne Baseball Federation, which has run high school and adult leagues in the Summit City since 1931, has also announced a donation of $500 to bring the overall total to $1,000.  

For more information, contact Gary Rogers at grogers@eacs.k12.in.us or Brett Windmiller at brett.windmiller@nacs.k12.in.us. 

Hard work, fun mix for Richards, Garrett Railroaders

By STEVE KRAH

http://www.IndianaRBI.com

Diligence and amusement don’t have to be mutually exclusive.

Not the way Garrett (Ind.) High School head baseball coach Jason Richards sees it.

“I do demand a lot from my players,” says Richards, who spent a decade of coaching in the Railroaders softball program then took over the baseball post prior to the 2020 season which was taken away by COVID-19. “At the same time, baseball has to still be fun for everybody.

“We want to still work hard for our goals.”

Richards was a softball assistant to Scott Bishop for eight seasons before leading the Garrett team in 2018 and 2019.

“(Bishop) demands perfection,” says Richards. “You’re only going to get that through hard work.”

Prior to Garrett, Richards was a baseball assistant at Central Noble for head coach Jim Sickafoose and baseball assistant Eastside for head coach Jason Pierce.

Richards says Sickafoose has an “old school” way of doing things.

“We had a good team,” says Richards, who helped the Cougars win an IHSAA Class 2A LaVille Sectional title and compete in the Whiting Regional in 2012. “(Coach Sickafoose) wanted to get the most out of everything you can do each day.

“(Coach Pierce) brought a fire for the game. He kept the kids on their toes, letting them know they can’t just go through the motions.”

A 1996 Churubusuco (Ind.) High School graduate, Richards played for Mark Grove.

“(Coach Grove) demanded perfection and hard work,” says Richards. “He was no-nonsense.”

Before class baseball, ‘Busco won Warsaw Sectional and Plymouth Regional crowns and competed in the Fort Wayne Semistate championship against eventual state runner-up Fort Wayne Concordia Lutheran at Fort Wayne’s Memorial Stadium in 1995. 

Richards went on to be a student at Indiana Purdue-Fort Wayne, where he earned a Education degree with a focus on middle school Social Studies and Science and later gained a School Counseling masters from the University of the Cumberlands in Williamsburg, Ky.

An attendee of several coaching clinics, Richards likes to run an organized practice. 

Everyday players show up they know everything is thought out and in a certain order.

“Anything after 2 1/2 hours and you start to see bad habits,” says Richards. “In 1 1/2 hours, we can get in there, word hard, get good habits formed and have fun.”

Garrett (enrollment around 580) is a member of the Northeast Corner Conference (along with Angola, Central Noble, Churubusco, Eastside, Fairfield, Fremont, Hamilton, Lakeland, Prairie Heights, West Noble and Westview). NECC teams play each other once apiece plus there’s a conference tournament.

“I hope we have a season,” says Richards. “I think we have a lot to look forward to.

“We should be competitive in a really competitive NECC.”

The Railroaders are in an IHSAA Class 3A sectional grouping with Angola, Fort Wayne Bishop Dwenger, Fort Wayne Bishop Luers, Fort Wayne Concordia Lutheran, Leo and New Haven. Garrett has won three sectional titles — the last in 1973. In recent years, the Railroaders have been rotating as a sectional and regional host.

At its size, the multi-sport athlete is the norm at Garrett. Many baseball players are on the football team and Richards is an assistant in program led by Chris DePew. That means Garrett had just a few participate in practices during fall IHSAA Limited Contact Period for baseball.

Winter workouts — bat and ball activities plus speed and agility and weight work — have regularly been drawing about 17 with the others involved in winter sports. Richards expects to have around 30 players for varsity and junior varsity teams.

Last March, Garrett was two days away from its first official day of practice when the pandemic caused a shutdown and loss of the 2020 season.

“What a crazy year,” says Richards. “We had like four kids play travel ball last year and no (Garrett Youth Baseball for ages 5-16). 

“COVID can really hurt a small program.”

A third year as a guidance counselor at Garrett Middle School (he was a science teacher prior to that), Richards gets to see student-athletes grow and mature for six years — grades 7-12.

“I build a relationship with them in middle school and earn that trust,” says Richards. “In high school, we get them what they need.”

Richards counts Rudy Fuentes as a varsity assistant coach for 2021. Other assistants are Clay Evans, Steve Orth, Bobby York and Cody Camp. Joe Fuentes (Rudy’s son) is GYB president.

The youth league will base its draft on performance at camps held at the high school in February.

“We work really well together,” says Richards of the accord between GHS and GYB.

Garrett graduate Tristan Taylor is a freshman on the baseball roster at Earlham College in Richmond, Ind. Current Railroaders senior Gage Smith is expected to make a college baseball commitment and a number of juniors also have college diamond aspirations.

Jason and wife Emily Richards have three children — Kierra (19), Trey (16) and Brady (8). Kierra Richards is a softball player and Exercise Science major at Grace College in Winona Lake, Ind. Trey Richards is a junior football and baseball players at Garrett. Third grader Brady Richards, who tuns 9 next week, is involved in football, wrestling and baseball.

Jason Richards is head baseball coach at Garrett (Ind.) High School. He is also a guidance counselor at Garrett Middle School.

VanArsdale builds Elkhart Christian culture of humility, hard work

RBILOGOSMALL copy

BY STEVE KRAH

http://www.IndianaRBI.com

When Tyler VanArsdale was asked to be the varsity baseball coach at Elkhart (Ind.) Christian Academy, the invitation came with a request.

Athletic director Richelle Viront wanted him to establish culture with the Eagles.

VanArsdale, a 2013 ECA graduate who had played baseball, golf and basketball at his alma mater, was a baseball assistant in 2017 and came back to lead the program in 2019.

“I’ve been preaching to the guys to stay humble and work hard,” says VanArsdale. “Humility is so valuable in a team sport.”

VanArsdale, who had also coached many of these same athletes as junior high basketball players, does not put the emphasis on personal statistics but the team.

“We talked about distractions,” says VanArsdale. “One huge one is pride.”

VanArsdale wants his players to know that “everyone matters” and that seniors with experience respect freshmen with little to none.

“When I see someone who is toxic to that culture, we’re addressing it head-on right away,” says VanArsdale. “At the end of the day, ECA baseball is about life development.”

VanArsdale saw the Eagles go from 1-11 in 2018 — a year he stayed out of coaching with the birth of his daughter (Bethel College graduates Tyler and Brittany welcomed Clara on their wedding anniversary of May 10, 2018 at 10:18 p.m.) — to 8-8 in 2019 with him in charge.

“It’s a mindset thing — a change in thinking,” says VanArsdale. “That’s a great turnaround.”

Elkhart Christian lost 4-0 to Fremont in the semifinals of the IHSAA Class 1A Fremont Sectional.

“It was intense and competitive,” says VanArsdale. “I was proud of the guys.”

Two seniors — Bailey Petty and Mark Stevens — were on that squad. Many players return for 2020. Stevens has joined a coaching staff that also includes Tony Tice and Chad Viront.

VanArsdale started his high school athletic career at nearby Penn.

As a sophomore, he transferred to ECA. He was allowed to play junior varsity basketball. The Eagles did not have a JV baseball team, but an arm injury ended his travel season early.

VanArsdale played basketball as a junior and season for squads that won 13 and 14 games.

His senior spring saw ECA go 21-8 and win the school’s first baseball sectional title, reigning at Hamilton and advancing to the finals of the 1A Caston Regional.

That team featured Caleb Stayton (who went on to a standout career at Ball State University) and Tanner Watson (who excelled at Taylor University) and VanArsdale keeps in-touch with many of his former teammates.

A former golf mate of Alec Dutkowski, VanArdale was also able to juggle the links and the diamond in the spring at ECA. He anticipates that he will have some baseball players also competing in track and field this spring.

During the IHSAA Limited Contact Period, the Eagles have been practicing on Tuesdays and Saturdays with weight workouts on other days.

Players and coaches are communication via group chat and VanArsdale, who is also account manager for Legacy Fire Protection, has lunch with his seniors — a group that will have at least six.

“I’m excited,” says VanArsale. “1 through 9, we’ll be stronger at the plate.

“With pitching, we lost Bailey Petty. But we’ll be more diverse and may use three pitchers in a game.”

To keep his pitchers healthy, VanArsdale has them using J-Bands, lifting weights and stretching in the off-season.

For those players who have their sights on the next level, the coach has advice.

“If you have a goal to play college ball, I preach prospect camps,” says VanArsdale. “You don’t want to get worn out on travel ball.”

While ECA (enrollment around 170) is an independent in all sports but soccer now, the school will be part of the Hoosier Plains Conference (with Argos, Bethany Christian, Lakeland Christian Academy, South Bend Career Academy and Trinity at Greenlawn), beginning in 2020-21. It will come with a double robin schedule and end-of-season recognition.

“It’s going to be really good,” says VanArsdale. “It’ll give each school something to shoot for.”

The Eagles are part of a 1A sectional grouping in 2020 and 2021 with Bethany Christian, Fort Wayne Blackhawk Christian, Fort Wayne Canterbury, Fremont, Hamilton and Lakewood Park Christian.

BAILEYPETTYTYLERVANARSDALEMARKSTEVENS

Elkhart (Ind.) Christian Academy head baseball coach Tyler VanArsdale (center) appears with Bailey Petty (left) and Mark Stevens on Senior Day 2019.

Guthrie eager to get going with Prairie Heights Panthers

RBILOGOSMALL copy

BY STEVE KRAH

http://www.IndianaRBI.com

T.J. Guthrie was just hired as the head baseball coach at Prairie Heights Community High School near LaGrange, Ind.

Guthrie and his coaching staff are young and eager to work with the Panthers.

“There’s not a staff out there more excited to get going,” says Guthrie, who at 26 is the oldest in a group that also includes Prairie Heights alums Tanner Perkins (who played at Indiana Tech in Fort Wayne), Mike Gustin (who played at Trine University in Angola, Ind.) and Zach Smith. “We’re young and connected to the community.

“We have to have the youngest aggregate age in the state.”

Guthrie’s hiring was approved by the school board too late for the fall Limited Contact Period. The next window for baseball activities opens in a little over a month.

“I’m counting down the days until Dec. 9, I know that,” says Guthrie. That’s when teams can have two-hour blocks twice-a-week for baseball activity. He plans to precede that with an hour of weight lifting and conditioning, putting  as baseball practice at 7:30 p.m. after winter sports practices.

“I want to give everybody an opportunity to get on board early,” says Guthrie.

Why conditioning before practice and not after?

“I want to see them perform when their legs are not fresh,” says Guthrie. This equates to being able to make plays late in games when they’re worn out.

Perkins pitched at Indiana Tech, where head coach Kip McWilliams ran practices with a fast tempo. Guthrie plans to adopt that style for his Panthers.

“I want to see how they (perform) in bottom of seventh when they’re worn out,” says Guthrie. “When you practice at a high pace, once you get in a game everything seems to slow down.”

Building Heights up from the bottom will be a priority.

“We’re going to make sure we focus on the little things a lot,” says Guthrie. “As part of part of our warm-up routine, infielders will be working on their hands and footwork every single day. Outfielders will be doing drop steps and sprinting to the baseball.

“We want to start from the ground up and make sure everything fundamental is correct. We want to make sure we play the game the right way.”

Guthrie also intends to use plenty of technology and metrics, using Blast Motion to measure launch angle and exit velocity.

“We’re top of the cage enthusiasts,” says Guthrie. “We’ll do a lot of weighted-bat training. We’ll work on our hit path and getting the barrel on a plane. It’s rotational hitting.

“We want to lead the conference and, ideally, the state in doubles and home runs.”

This is Guthrie’s second stint on the Panthers staff. He wound up a run after the 2017 working with Nick Pfafman, who left to join head coach Greg Perschke at Trine.

A 2011 Fremont (Ind.) High School graduate who played for Eagles head coach Justin Bock, Guthrie went to Trine to be a pitcher and first baseman. He blew out his elbow in the first couple of practices and opted to focus on his studies and earn an accounting degree which he now puts to use with marketing and sales for his parents’ business, Casey’s Cove Marina on Crooked Lake in Angola.

Guthrie got his coaching start in the Sandy Koufax League in Fremont and coached in travel ball with the Indiana Elite and Sturgis, Mich.-based Hitters Edge.

Prairie Heights plays on-campus at Kellett Field, a facility that has been recently edged and is going through infield work. There are now double-barrel bullpens on both sides of the field. A year ago, the field got new fencing. The playing surface and irrigation system went in five years ago. There are no lights.

“The field is going to play very nice,” says Guthrie. “We have maintenance staff ready to help us out.”

While he has a young squad and no current college baseball commitments, Guthrie has players with those aspirations.

“I’ll put a big emphasis on trying to get guys to the next level,” says Guthrie. “I’m working hard to develop relationships with a lot of these area junior colleges (including Glen Oaks Community College in Centreville, Mich., and Ivy Tech Northeast in Fort Wayne).”

Recent Prairie Heights graduate Jacob Heller also played baseball at Trine.

Four communities with their own youth leagues — Stroh, South Milford, Ashley-Hudson and Orland — feed into Prairie Heights and Guthrie intends to become a familiar face to those players and coaches.

“A number of players are in travel baseball,” says Guthrie. “I want wake sure I’m getting involved with the guys that are staying local and get them ready for high school.”

Prairie Heights (enrollment around 410) is a member of the Northeast Corner Conference (with Angola, Central Noble, Churubusco, Eastside, Fairfield, Fremont, Garrett, Hamilton, Lakeland, West Noble and Westview).

Each team plays each other once with the home team alternating from year to year. There’s also an in-season tournament. Teams are guaranteed two games. Most weekday games are played at 5:30 p.m.

The Panthers are part of an IHSAA Class 2A sectional grouping with Bremen, Central Noble, Fairfield, LaVille and Westivew. Prairie Heights has won two sectional titles — 1977 and 1984.

T.J. and Cheyene Guthrie were high school sweethearts. The couple, which resides in Angola, celebrated four years of marriage in September.

TJGUTHRIE

T.J. Guthrie is the new head baseball coach at Prairie Heights Community High School near LaGrange, Ind. He has recently been coaching travel ball for Hitters Edge.

TJGUTHRIEHITTERSEDGE

T.J. Guthrie (right) stands with a trophy he won in a coaches home run derby at a Gameday USA travel tournament with Hitters Edge. Celebrating with him are former player T.J. Vanderkuyl and assistant coach Jacob Summers. Guthrie is a 2011 Fremont (Ind.) High School graduate who recently became head baseball coach at Prairie Heights Community High School near LaGrange, Ind.

TJCHEYENEGUTHRIET.J. and Cheyene Guthrie take in a baseball game. T.J. Guthrie is now head baseball coach at Prairie Heights Community High School near LaGrange, Ind.

 

NECC Home Run Derby promotes baseball, cancer awareness

RBILOGOSMALL copy

By STEVE KRAH

http://www.IndianaRBI.com

As a way of promoting baseball and helping the community, two senior ballplayers at Lakeland Junior/Senior High School in LaGrange, Ind., came up with an idea.

Jayce Riegling and Braden Yoder decided to organize a home run derby and invited other players from the Northeast Corner Conference to participate.

Sixteen hitters representing nine of the conference’s 12 schools — Angola (where Roger Roddy is head coach), Central Noble (Tyler Graybeal), Fairfield (Darin Kauffman), Fremont (Justin Bock), Garrett (Jason Richards), Lakeland (Michael Isaacs), Prairie Heights (T.J. Guthrie), West Noble (Doug Brown), and Westview (Jason Rahn) — are slated to slug it out, beginning at 3 p.m. Sunday, Nov. 3 on the Lakeland diamond.

There will be four rounds with batters seeing how many homers they can hit in three minutes.

All proceeds from the event, which has 48 corporate sponsors, will be going to Hello Gorgeous!, a non-profit organization that provides complimentary, professional makeovers and cosmetic education to all women battling all cancers. Organizers says that more than $5,000 has already been raised.

Tickets will be on sale the day of the event for $3. T-shirts will also be sold. To keep spectators fed, the MADD Chef Creationz food truck will be there, too.

Why an NECC Home Run Derby?

“Everyone loves home runs,” says Riegling. “I want to be an agent. I was talking to some (sports) agents. They told me to come up with baseball projects.”

After batting around a few ideas, they settled on bringing in players with the pitcher of their choice for a home run derby.

“It helps the community better,” says Riesling. “It gets us closer.”

Yoder, who is considering a career in engineering, sees his role in the project as the proof reader and aesthetic editor.

“I try to make everything look nice,” says Yoder. “I’m more behind the scenes. I keep things straight.

“This is going to be a fun event. I’m excited. It’s the first time I’ve ever done anything like this. So far it’s turned out perfectly.”

Yoder says permission forms need to be finalized, but they will welcome participation by younger kids to shag balls.

The event was originally scheduled for May 2020, but the IHSAA informed the organizers that players could not participate in-season so the date was changed.

If the weather does not cooperate Sunday, back-up dates are Nov. 9 and 10. Updates will be placed on the project’s Twitter page — @NECC_HRD.

Most of the participants came to a media day sponsored by Shipshewana Trading Place.

Here’s what the many of the hitters had to say:

Felipe Arevalo (Fairfield): “This is a very nice project … We all love baseball. This will be my first home run derby. It’s going to be fun … (Coach Kauffman) talks about hitting the ball hard.”

Brayden Bontrager (Lakeland): “I just love the game. Baseball is a fun sport to play. I always like to hit home runs … Home runs are the best part of the game. It rallies the team … (Coach Isaacs) is more of a contact guy, get guys on-base … The ball travels here in left field. There’s a cornfield out there.”

Nathan Burr (Central Noble): “I’ve never heard about anything else like this in high school. I thought it would be fun to be part of the first one … This is a great cause — cancer awareness. I’m real excited.”

Tyler Curtis (Prairie Heights): “I like hitting dingers. I like the competition … Last year I had one (homer) on varsity … Rotational hitting (which I learned at Hitters Edge in Sturgis, Mich.) is a big thing. A big shoutout to Mike Marks and Robert Riley … Stamina is a big thing we don’t focus on (in a home run contest). You have to control your breathing.”

Camden “Bodhi” Hall (Prairie Heights): “(Bodhi) comes from a movie called Point Break with Patrick Swayze. My dad just wanted to name me that. He still calls me Bodhi … Tyler Curtis and I wanted to represent our school and show them what we’ve got as sophomores … Tyler and I were in a home run derby together while with the Hitter’s Edge. He was first and I second one year … (Hitter’s Edge coach Mike Marks) is great. You go up there, you’ll learn something.”

Camden Harris (Garrett): “I had four (home runs) last spring (behind senior Kobe Lucarelli’s six) … This will be my third (home run contest). I was in seventh grade and we were in Kentucky for nationals (in travel ball) and I got second place. As a freshman or sophomore, I was down in Florida and got first place.”

Connor Kreis (Fremont): “I heard about a slogan like ‘Swinging for Cancer’ or something like that. I figured it was going for a good cause. It’s just cool to get out here and see these other athletes that I’ve played against since I was a freshman.”

Owen Miller (Fairfield): “I hit two home runs last year. One was a grand slam (at Lakeland) … You have to have a good pitcher (Owen’s father, Tim Miller, will pitch to him) and you need to be confident.”

Nick Mortrud (Westview): “I thought it would be fun to do something to bring the schools together … In a way, this helps the school kind of showcase what they’ve got … We’re bringing the community here, too … I was in a home run contest in travel ball at around 10 (in Columbus, Ohio) at ended up winning it … I’m going to be thinking don’t take too many wasted swings. After each swing kind of analyze what you’re doing. Focus on what you’re body’s doing as you take the swing.”

Hunter Saggars (West Noble): “(Jayce) and I go way back. We used to play ball together … I’ve never seen anything like this before so I figured it would be cool to be a part of the first one … I’m not going into this thing thinking I’m going to win it. We’ve got some big boys. I just want to be a part of it … (2019 West Noble graduate) Jorge Villanueva will be throwing to me.”

Takota Sharick (Westview): “My Grandma has cancer so this is really important to me … I’m not necessarily a power hitter, but if I focus on it I can be alright … We use Blast Motion and (Coach Rahn) tells us when we’ve had good launch angle and bat speed.”

Gage Smith (Garrett): “We’ve got three (derby competitors) looking pretty sharp, honestly … I would honestly consider myself a power hitter (with four homers for the Railroaders last spring) … A Garrett cop (Kylan LaMotte) will be throwing to us.”

Evan Snyder (Churubusco): “I was in a home run derby a long time ago in Cooperstown. I hit one … It’s a good thing they’re doing this for, the charity.”

Tristan Taylor (Garrett): “We’re all a tight-knit group (at Garrett). All three of us are chatting and having a competition amongst ourselves. It’ll be fun … It’s a really good opportunity to support this charity. It’s a really good organization … Everything about this is great.”

NECC HR DERBY

At Lakeland

Sunday, Nov. 3, 3:30 p.m.

Bracket 1

First Round

Nick Mortrud (Westview jr.) vs. Brayden Bontrager (Lakeland jr.)

Gage Smith (Garrett jr.) vs. Dylan Eggl (Central Noble jr.)

Camden Harris (Garrett sr.) vs. Camden “Bodhi” Hall (Prairie Heights so.)

Owen Miller (Fairfield so.) vs. Connor Kreis (Fremont sr.)

Bracket 2

First Round

Tyler Curtis (Prairie Heights so.) vs. Evan Snyder (Churubusco jr.)

Nathan Burr (Central Noble sr.) vs. Kolton Taylor (Lakeland sr.)

Tristan Taylor (Garrett sr.) vs. Felipe Arevalo (Fairfield sr.)

Hunter Saggars (West Noble sr.) vs. Takota Sharick (Westview jr.)

NECCHRDERBYBRACKETS

The NECC Home Run Derby brackets for 2019. (Steve Krah Photo)

NECCHRDERBYLOGO

The Northeast Corner Conference Home Run Derby with proceeds to benefit Hello Gorgeous! is slated for Sunday, Nov. 3 at Lakeland Junior/Senior High School in LaGrange, Ind. (Steve Krah Photo)

 

Kinnison helping Blackhawk Christian baseball players reach their goals

RBILOGOSMALL copy

BY STEVE KRAH

http://www.IndianaRBI.com

Kevin Kinnison is a facilitator.

As head baseball coach at Blackhawk Christian School in Fort Wayne, Ind., Kinnison helps gets athletes where they need to go.

“As a Class A school, we focus on individuals striving to be consistent and the best they can be,” says Kinnison, who has led the Braves since the 2009 season and knows he has some players who see high school as the end of their baseball careers and others who want more. “We push some to where they want to go.”

Baseball is a team sport, but Kinnison sees it as an opportunity to “play against yourself.”

Individuals find what they can do and how they fit into the puzzle and push themselves — even when no one is watching.

“The game should be easy,” says Kinnison. “Practice should be hard. It’s human nature to only do as much as someone would push you to do.

“We want the best version of you on the ball field. Give me 100 percent of what you have today.

“You’re responsible for what you do. At the end of the day, results are bases on the work you put in.”

Kinnison encourages his players to study the game and the opponent.

“Figure out a weakness and exploit it,” says Kinnison. “If you’re fast, steal bases.

“I don’t think kids think the game as much as they could. They just play.”

College-bound players, especially, will be served by understanding the game.”

Recent graduates to play college baseball include Nathan Targartt and Kole Barkhaus at Taylor University in Upland, Ind., and Nate Moonen at  Olivet Nazarene University in Bourbonnais, Ill. Current Blackhawk Christian junior Callan Wood is among those with college baseball aspirations.

“We give as much information as we have as a staff,” says Kinnison, who is assisted by Matt Harmon (the Harmon brothers — Mark, Matt and Jake — were involved in bringing state titles to Blackhawk in 2002, 2005 and 2006), Brice Urschel, Nick Braun and Ryan Davis. Harmon and Braun are BCS teachers. Urschel played for Kinnison then at Huntington (Ind.) University.

Some things become instinctual.

“We don’t use signs very much,” says Kinnison. “We take what they’re giving us.”

Kinnison is a 1988 Fort Wayne Snider High School graduate who played baseball for three years for Jim Russo then one for Dave Hay as well as football for Mike Hawley and two years of basketball before playing baseball at Garden City (Kan.) Community College and Huntington College (now Huntington University) for Indiana High School Baseball Coaches Association Hall of Famer Mike Frame.

“(Frame) had a greater influence on me after I left than when I was there,” says Kinnison. “He is probably one of the best ambassadors for baseball in northeast Indiana.”

Kinnison was a lead-off or No. 9 hitter who would bunt on his own.

As a coach, he is not inclined to insist his Blackhawk Christian batters lay one down. He usually leaves it up to them.

“I don’t like to take the bat of the the kids’ hands if they going good,” says Kinnison.

After college, Kinnison was an assistant to Matt Kinzer at Indiana Purdue Fort Wayne (now Purdue Fort Wayne) and coached for the independent Richmond (Ind.) Roosters, run by IHSBCA Hall of Famer John Cate.

Kinnison, who was assistant director of construction for a retail investment company in Cincinnati and came back to Fort Wayne on the weekends, was encouraged to apply for the Blackhawk Christian job by Kinzer.

Blackhawk Christian (enrollment around 240 for high school in the K-12 system) is an independent.

Among teams the BCS played in 2019 were Bellmont, DeKalb, Fort Wayne Canterbury, Fort Wayne South Side, Fort Wayne Wayne, Fremont, Heritage, Homestead, Lakewood Park Christian, New Haven, Northfield, Prairie Heights, Southern Wells and Woodlan.

Athletic director Joel Cotton makes up the schedule with some input from the coach.

“I didn’t want a bunch of 1A schools on it,” says Kinnison. “I would rather take our lumps (and get better against tougher competition).

“It’s about taking pride in performing. The team that is able to relax and play their normal game can beat you.”

Since Kinnison has been in charge, there has only been a varsity team with about 18 to 20 players per season. For 2020, he expects to have two seniors, two juniors and seven or eight sophomores.

As a way of supporting the school, all players help with a program established in 2011 by BCS Foundation, Inc., called reNEW Upscale Resale.

The Braves part of an IHSAA Class 1A sectional grouping with Bethany Christian, Elkhart Christian Academy, Fort Wayne Canterbury, Fremont, Hamilton and Lakewood Park Christian. Blackhawk has won 14 sectional titles — the last in 2017.

Blackhawk Christian played only a handful of games on-campus in 2019 because of wet conditions. The rest of their home dates were contested on the turf at the ASH Centre, home of the World Baseball Academy.

Kevin and Annette Kinnison have three daughters — Taylor, Kenzie and Karlee. Taylor is 22. Eighth grader Kenzie and sixth grader Karlee have attended Blackhawk since they were in kindergarten. Kevin is co-owner of Blue Apple Construction.

KEVINKINNISONBLACKHAWK

Kevin Kinnison has been the head baseball coach at Blackhawk Christian School in Fort Wayne, Ind., since the 2009 season. He played at Fort Wayne Snider High School, Garden City (Kan.) Community College and Huntington (Ind.) College (now Huntington University). (Steve Krah Photo)

 

 

 

Graybeal getting Central Noble Cougars ready for baseball, life

RBILOGOSMALL copy

BY STEVE KRAH

http://www.IndianaRBI.com

As a high school educator, Tyler Graybeal sees his job as getting his students ready for what comes after school while enjoying their time in it.

That explains the points of emphasis for the head baseball coach at Central Noble Junior/Senior High School in Albion, Ind.

“It’s not wins and losses, it’s doing the right thing,” says Graybeal, who enters his second season of leading the Cougars in 2020 (he was an assistant to Jim Sickafoose in 2018). “We’re preparing them for the next step in life. We want them to have a good time and get better at baseball.”

Graybeal, who teaches Geometry during the school day, has been conducting limited contact sessions twice a week and is pleased with the turnout of high schoolers and middle schoolers.

“We had 17 the past two fall workouts,” says Graybeal, who is also an assistant football coach at Central Noble working with linebackers and wide receivers and serving as junior varsity defensive coordinator. “We have a scrimmage once a week. We’ve set up a mentoring system so the older players can learn to be role models.”

The high school’s feeder program is a league run through Albion Parks with fields at Hidden Diamonds Park and Valleyview Park.

Graybeal, who had 28 players in the entire high school program last spring, says a young 2019-20 squad includes junior Dylan Eggl and senior Nate Burr among its top players. Eggl is power hitter, shortstop and right-handed pitcher. Burr, a transfer from Westview High School, is 6-foot-6 and 250 pounds and is a righty pitcher and first baseman. Both are undecided about college.

A graduate of Crestview High School in Ashland, Ohio, Graybeal got his college degree from the University of Mount Union in Alliance, Ohio, where he briefly played baseball. An insurance job brought him to Fort Wayne and then he decided to go into education and coaching.

When he first came to Central Noble, Graybeal was a coach for all high school seasons — football, basketball and baseball. His wife, Elizabeth, insisted that he cut back on that load so basketball was dropped. The couple has a 5-year-old son named Draven and are expecting a second child in January.

At a small school like Central Noble (enrollment around 440), multi-sport athletes are the expectation.

“I encourage my kids to play another sport,” says Graybeal. “You’ve got to be a well-rounded athlete.

“That’s why I coach multiple sports so I see those kids as much as I can and work with them.”

Also working with the baseball players is a coaching staff that features JV head coach Shane Austrap and assistants Justin Stump, Max Smith and Jared Shishler.

Since taking over the Cougars on the diamond, Graybeal and others have worked to improve the home field. Sod has been cut, dugouts have been painted and there’s plenty more to do. An August fundraiser — a coed slow pitch softball tournament — will help with the upgrades.

Central Noble is a member of the Northeast Corner Conference (with Angola, Churubusco, Eastside, Fairfield, Fremont, Garrett, Hamilton, Lakeland, Prairie Heights, West Noble and Westview).

The first NECC Home Run Derby originally slated for May has been moved to 3 p.m. Sunday, Nov. 3 at Lakeland.

The Cougars are part of an IHSAA Class 2A sectional grouping with Bremen, Fairfield, LaVille, Prairie Heights and Westview. Central Noble has won three sectional titles — 2009, 2010 and 2012.

CENTRALNOBLEBASE19

The 2019 Central Noble High School baseball team. It was the first one with Tyler Graybeal as head coach.

TYLERGRAYBEAL

Tyler Graybeal is head baseball coach at Central Noble Junior/Senior High School in Albion, Ind. He also assists in football and teaches Geometry. He is a graduate of Crestview High School and the University of Mount Union — both in Ohio.